(data stored in ACNUC7421 zone)

EMBL: CP000283.PE288

CP000283.PE288       Location/Qualifiers
FT   CDS             complement(334887..335534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0290"
FT                   /product="heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37528"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG1"
FT                   /protein_id="ABE37528.1"
FT                   /translation="MAIDSSKFFDKIRVKPTKAEAAREAAREQVIMCDAPGCANRGAHR
FT                   APKGRGLEKDYWHFCLNHVREYNQGYNFFEGMNADAVARYQKDALTGHRPTWKMGQNGA
FT                   KSRTKNPEDLAGAADPFEVINEFNGRSRWRRGPDPSAEQTKSEPRKVFNAERKALQVMG
FT                   LDGDATLDIVKAKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRA"
     MAIDSSKFFD KIRVKPTKAE AAREAAREQV IMCDAPGCAN RGAHRAPKGR GLEKDYWHFC        60
     LNHVREYNQG YNFFEGMNAD AVARYQKDAL TGHRPTWKMG QNGAKSRTKN PEDLAGAADP       120
     FEVINEFNGR SRWRRGPDPS AEQTKSEPRK VFNAERKALQ VMGLDGDATL DIVKAKYKAL       180
     VKQHHPDANG GDRSTEDRLI EIIKAYNYLK TVVRA                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page