(data stored in ACNUC7421 zone)

EMBL: CP000283.PE292

CP000283.PE292       Location/Qualifiers
FT   CDS             complement(338433..339047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0294"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37532"
FT                   /db_xref="GOA:Q13EF7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF7"
FT                   /protein_id="ABE37532.1"
FT                   /translation="MSEIAPPADAARSQEAEIVAALGERAVVLIGMMGAGKSTVGRRLA
FT                   LRLGLPFLDADTEIESAAAMTIPEIFDTHGEPHFRDGEARVIARLLDGGAKVLATGGGA
FT                   FMREETRDRIRDKAVSLWLEADADVILRRVKRRADRPLLKTPDPAGTIARLIDERYPVY
FT                   RSADLTIASRDVPHEKIVDECVAALHGYLCCAAAPTLSETP"
     MSEIAPPADA ARSQEAEIVA ALGERAVVLI GMMGAGKSTV GRRLALRLGL PFLDADTEIE        60
     SAAAMTIPEI FDTHGEPHFR DGEARVIARL LDGGAKVLAT GGGAFMREET RDRIRDKAVS       120
     LWLEADADVI LRRVKRRADR PLLKTPDPAG TIARLIDERY PVYRSADLTI ASRDVPHEKI       180
     VDECVAALHG YLCCAAAPTL SETP                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page