(data stored in ACNUC7421 zone)

EMBL: CP000283.PE293

CP000283.PE293       Location/Qualifiers
FT   CDS             339225..339371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37533"
FT                   /db_xref="GOA:Q13EF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF6"
FT                   /protein_id="ABE37533.1"
FT                   /translation="MPTLFRFLSVVAVIGGIIYGTIFALANFVSPKSREMTVVVPADKF
FT                   LKK"
     MPTLFRFLSV VAVIGGIIYG TIFALANFVS PKSREMTVVV PADKFLKK                     48
//

If you have problems or comments...

PBIL Back to PBIL home page