(data stored in ACNUC7421 zone)

EMBL: CP000283.PE295

CP000283.PE295       Location/Qualifiers
FT   CDS             340595..341569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0297"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37535"
FT                   /db_xref="GOA:Q13EF4"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF4"
FT                   /protein_id="ABE37535.1"
FT                   /translation="MSLVMSEPMRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEVSR
FT                   IEEKAAQALNELYAALTPWQKTQVARHPQRPHCVDYIQGLITEFTPLAGDRKFGEDEAL
FT                   IGGFGRFRGESICVLGQEKGSSTETRLKHNFGMARPEGYRKAVRLMEMADRFGIPVLSL
FT                   VDTAGAYPGIGAEERGQAEAIARSTDACLQLGVPNVAVVIGEGGSGGAIAIATANKVLM
FT                   LEHAIYSVISPEAASSILWRDGTKAQEAANSMKITAQDLLRFGVIDQILAEPKGGAHRD
FT                   PEAMIATTGDAIAAAFAELNGLDSSTVRNKRRQKFLEIGRKLG"
     MSLVMSEPMR SYLDFEKPVA ELDSKIDELR TLAASGSDIH EEVSRIEEKA AQALNELYAA        60
     LTPWQKTQVA RHPQRPHCVD YIQGLITEFT PLAGDRKFGE DEALIGGFGR FRGESICVLG       120
     QEKGSSTETR LKHNFGMARP EGYRKAVRLM EMADRFGIPV LSLVDTAGAY PGIGAEERGQ       180
     AEAIARSTDA CLQLGVPNVA VVIGEGGSGG AIAIATANKV LMLEHAIYSV ISPEAASSIL       240
     WRDGTKAQEA ANSMKITAQD LLRFGVIDQI LAEPKGGAHR DPEAMIATTG DAIAAAFAEL       300
     NGLDSSTVRN KRRQKFLEIG RKLG                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page