(data stored in ACNUC7421 zone)

EMBL: CP000283.PE297

CP000283.PE297       Location/Qualifiers
FT   CDS             complement(343844..346684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0299"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37537"
FT                   /db_xref="GOA:Q13EF2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EF2"
FT                   /protein_id="ABE37537.1"
FT                   /translation="MIGAFARKLFGSSNDRRIKAYQARVAAINALEPDVAALSDEALRA
FT                   RTDQFRAELAAGKTLDDLLIPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLACYLNALAGKGVHVVTVNDYLASRDAGWMGQIYAFLGMSTGVIVHGLDD
FT                   SQRQKAYACDITYGTNNEYGFDYLRDNMKYRLEDMAQRGHFFAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSEFYNTIDTFIPRLDKSDYDVDEKQRSVALTEAGMEKIETLLRDAGQLK
FT                   GESLYDIENVSVVHHINQALRAHTLFQRDKDYIVRNDEVVIIDEFTGRMMQGRRYSEGL
FT                   HQALEAKEHVTVQPENQTLASITFQNYFRMYGKLAGMTGTAATEADEFYDIYKLEVVEI
FT                   PTNVTIARLDEDDEVYRTQTEKYAAILAEVERANKRLQPVLVGTASIEKSEVLADVLLK
FT                   SGYKQIDFGDPKALEKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIATN
FT                   MAGRGTDIKLGGSLEMRIQQETADITDEAEKAARIEQIKADIERFRQIVLNAEDEVEIE
FT                   PAKGNKPAKTAKRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLMR
FT                   IFGSGKLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDDVQNDQ
FT                   RKVIFDQRIELMKEDSVVETVTDMRHTFIEDLVSKHVPEHAYAEQWDVAGLKEELNRVV
FT                   GLDIPVDEWAKEEGIADEELLVRLEKVFDEHMAAKVAQWGPDVMRYAEKSILLQTLDHL
FT                   WREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFNLFQEMSAHLREAVTAQLMRVEIIP
FT                   PEQPRELPPMEVHKMDPNTGEDEMQFANVSLAPADTVEKSERDPNRPESWGKVGRNEDC
FT                   PCGSGKKYKHCHGRYA"
     MIGAFARKLF GSSNDRRIKA YQARVAAINA LEPDVAALSD EALRARTDQF RAELAAGKTL        60
     DDLLIPAFAT VREAAKRTLG QRHFDVQLIG GMVLHEGDIA EMKTGEGKTL VATLACYLNA       120
     LAGKGVHVVT VNDYLASRDA GWMGQIYAFL GMSTGVIVHG LDDSQRQKAY ACDITYGTNN       180
     EYGFDYLRDN MKYRLEDMAQ RGHFFAIVDE VDSILIDEAR TPLIISGPLD DRSEFYNTID       240
     TFIPRLDKSD YDVDEKQRSV ALTEAGMEKI ETLLRDAGQL KGESLYDIEN VSVVHHINQA       300
     LRAHTLFQRD KDYIVRNDEV VIIDEFTGRM MQGRRYSEGL HQALEAKEHV TVQPENQTLA       360
     SITFQNYFRM YGKLAGMTGT AATEADEFYD IYKLEVVEIP TNVTIARLDE DDEVYRTQTE       420
     KYAAILAEVE RANKRLQPVL VGTASIEKSE VLADVLLKSG YKQIDFGDPK ALEKLYAAAR       480
     AGKPAKLFAV LNARFHEQEA YIVAEAGVPG AITIATNMAG RGTDIKLGGS LEMRIQQETA       540
     DITDEAEKAA RIEQIKADIE RFRQIVLNAE DEVEIEPAKG NKPAKTAKRP GGLYIIGSER       600
     HESRRIDNQL RGRSGRQGDP GRSKFFLSLE DDLMRIFGSG KLDTMLTRLG LKEGEAIIHP       660
     WINKALEKAQ QKVEARNFDI RKNLLKFDDV QNDQRKVIFD QRIELMKEDS VVETVTDMRH       720
     TFIEDLVSKH VPEHAYAEQW DVAGLKEELN RVVGLDIPVD EWAKEEGIAD EELLVRLEKV       780
     FDEHMAAKVA QWGPDVMRYA EKSILLQTLD HLWREHLVML DHLRQVIGLR GYGQRDPLQE       840
     YKSEAFNLFQ EMSAHLREAV TAQLMRVEII PPEQPRELPP MEVHKMDPNT GEDEMQFANV       900
     SLAPADTVEK SERDPNRPES WGKVGRNEDC PCGSGKKYKH CHGRYA                      946
//

If you have problems or comments...

PBIL Back to PBIL home page