(data stored in ACNUC7421 zone)

EMBL: CP000283.PE302

CP000283.PE302       Location/Qualifiers
FT   CDS             complement(352495..353367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0304"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37542"
FT                   /db_xref="GOA:Q13EE7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE7"
FT                   /protein_id="ABE37542.1"
FT                   /translation="MMTPRAATLIGLSAILMWSLLAVLTVATGTIPPFQLAAMTFAIGA
FT                   LAAATGWILRPGAIRALRQPPLVWAVGVGGLFGYHALYFLALRLAPPAEAGLLNYLWPL
FT                   LIVLFSSLLPGERLRPHHIAGALLGLVGTALLFTGNGAALEPAYLPGLAAAFVAAFVWA
FT                   AYSVLSRRLKAVPTDAVAGFCFVTALLAALVHGVIESTVWPQGAAQWLAIVALGIGPVG
FT                   AAFYAWDIGMKRGDIRVLGAASYATPLLSTGFLIIAGYAQPTATLALAALLIAGGGLLA
FT                   ARDMLRGGK"
     MMTPRAATLI GLSAILMWSL LAVLTVATGT IPPFQLAAMT FAIGALAAAT GWILRPGAIR        60
     ALRQPPLVWA VGVGGLFGYH ALYFLALRLA PPAEAGLLNY LWPLLIVLFS SLLPGERLRP       120
     HHIAGALLGL VGTALLFTGN GAALEPAYLP GLAAAFVAAF VWAAYSVLSR RLKAVPTDAV       180
     AGFCFVTALL AALVHGVIES TVWPQGAAQW LAIVALGIGP VGAAFYAWDI GMKRGDIRVL       240
     GAASYATPLL STGFLIIAGY AQPTATLALA ALLIAGGGLL AARDMLRGGK                  290
//

If you have problems or comments...

PBIL Back to PBIL home page