(data stored in ACNUC7421 zone)

EMBL: CP000283.PE307

CP000283.PE307       Location/Qualifiers
FT   CDS             358341..358739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37547"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE2"
FT                   /protein_id="ABE37547.1"
FT                   /translation="MRGGARNEALRGGIFLAMIPLRRCERLEMVQVQTMTKIWIDQGDD
FT                   DIRDFGADHDAEPELIETLPAPVTPVQPRMRYTDRPVRPSSNFIAQLMAIDRGNPHPRE
FT                   APRAEQNQATAAYRSAKTYAAGRTRRVS"
     MRGGARNEAL RGGIFLAMIP LRRCERLEMV QVQTMTKIWI DQGDDDIRDF GADHDAEPEL        60
     IETLPAPVTP VQPRMRYTDR PVRPSSNFIA QLMAIDRGNP HPREAPRAEQ NQATAAYRSA       120
     KTYAAGRTRR VS                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page