(data stored in ACNUC7421 zone)

EMBL: CP000283.PE308

CP000283.PE308       Location/Qualifiers
FT   CDS             complement(358756..359406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37548"
FT                   /db_xref="GOA:Q13EE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE1"
FT                   /protein_id="ABE37548.1"
FT                   /translation="MSIIGFPLLLIPLAICNIVVFLMPGVGFDAPLTRIPLPSGTIWTI
FT                   SAGEMLVALGVLMLLFEVIKAARPGAKYLTDHLLSLLVLGGTVAEFVMLPQFGNATVFL
FT                   LATLMLVDFLAGIALRHQPQPRTAGHARSRSVAKVDLPQQEPAVAAAPAAETPVAPFPT
FT                   ATAASISAASIAEAVLLDRPQPVASPKASASSPRIQSPGLQPADAAAGVQPPR"
     MSIIGFPLLL IPLAICNIVV FLMPGVGFDA PLTRIPLPSG TIWTISAGEM LVALGVLMLL        60
     FEVIKAARPG AKYLTDHLLS LLVLGGTVAE FVMLPQFGNA TVFLLATLML VDFLAGIALR       120
     HQPQPRTAGH ARSRSVAKVD LPQQEPAVAA APAAETPVAP FPTATAASIS AASIAEAVLL       180
     DRPQPVASPK ASASSPRIQS PGLQPADAAA GVQPPR                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page