(data stored in ACNUC7421 zone)

EMBL: CP000283.PE309

CP000283.PE309       Location/Qualifiers
FT   CDS             complement(359642..359824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0311"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37549"
FT                   /db_xref="GOA:Q13EE0"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EE0"
FT                   /protein_id="ABE37549.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADALKRPTYAEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVIKKKDA"
     MAVPRRKTSP SRRGMRRSAD ALKRPTYAED KDSGELRRPH HLDLKTGMYK GRQVIKKKDA        60
//

If you have problems or comments...

PBIL Back to PBIL home page