(data stored in ACNUC7421 zone)

EMBL: CP000283.PE31

CP000283.PE31        Location/Qualifiers
FT   CDS             complement(38412..38798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37271"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F68"
FT                   /protein_id="ABE37271.1"
FT                   /translation="MPTRAPVPQGEAERSKIPAELEAFFEVAERWRLSAEEQIVLLGSP
FT                   GRSTFFKWKKEGATLPADTRERLSHILGIWKSLRILFTQDDRGEAWIRAKNRYFDGASA
FT                   IDVMLEGMVGLIRVRRYLDAQRGG"
     MPTRAPVPQG EAERSKIPAE LEAFFEVAER WRLSAEEQIV LLGSPGRSTF FKWKKEGATL        60
     PADTRERLSH ILGIWKSLRI LFTQDDRGEA WIRAKNRYFD GASAIDVMLE GMVGLIRVRR       120
     YLDAQRGG                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page