(data stored in ACNUC7421 zone)

EMBL: CP000283.PE312

CP000283.PE312       Location/Qualifiers
FT   CDS             361795..362481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0314"
FT                   /product="protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37552"
FT                   /db_xref="GOA:Q13ED7"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED7"
FT                   /protein_id="ABE37552.1"
FT                   /translation="MSREAPDDPRLLRFRKLPRAVRVVVSRPRLFISVAVGVIAALLLP
FT                   ASLRPVTRALIGWDVSIVVYLALAFSMMARCDIDYIRRNAVLQDDGRFLILMVTATGAF
FT                   ASIAAIVAELGSGHRGAAELALATVTIALSWAAVHTTFALHYAHEYYRGAQVGGLQFPS
FT                   GDTHEDADYWDFVYFSFVIGMTAQVSDVGITDKTIRRTATAHGVVSFVFNTALVALMVN
FT                   IAAGAI"
     MSREAPDDPR LLRFRKLPRA VRVVVSRPRL FISVAVGVIA ALLLPASLRP VTRALIGWDV        60
     SIVVYLALAF SMMARCDIDY IRRNAVLQDD GRFLILMVTA TGAFASIAAI VAELGSGHRG       120
     AAELALATVT IALSWAAVHT TFALHYAHEY YRGAQVGGLQ FPSGDTHEDA DYWDFVYFSF       180
     VIGMTAQVSD VGITDKTIRR TATAHGVVSF VFNTALVALM VNIAAGAI                    228
//

If you have problems or comments...

PBIL Back to PBIL home page