(data stored in ACNUC7421 zone)

EMBL: CP000283.PE316

CP000283.PE316       Location/Qualifiers
FT   CDS             complement(367135..368049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0318"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37556"
FT                   /db_xref="GOA:Q13ED3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED3"
FT                   /protein_id="ABE37556.1"
FT                   /translation="MSSISSAVARPLSAGAIALMLLCCFSWGFNQIAVKLVLPEIPPFL
FT                   QAAMRSIAGLIVILIIAWARGVKLFQRDGTLKAGLLAGVLFGIEFVLIYRGLLLTTASR
FT                   GVVFLYTAPFIVALGSYHFLGERLRTLQWAGLALSFAGVALAIGVPQPDVDATVLIGDL
FT                   MLVGGGAMWGATTLIVKASRLQQAPAEKGLAYQVAISIPILLLAALISGETIDKMPGPL
FT                   SLTLMAYQSIWVVGLTFLLWFGLVKTYSASKLSAFTFITPLFGVAAGYLIMHDPLNPAF
FT                   GVAALLVIAGLYLVNRPAKAVPA"
     MSSISSAVAR PLSAGAIALM LLCCFSWGFN QIAVKLVLPE IPPFLQAAMR SIAGLIVILI        60
     IAWARGVKLF QRDGTLKAGL LAGVLFGIEF VLIYRGLLLT TASRGVVFLY TAPFIVALGS       120
     YHFLGERLRT LQWAGLALSF AGVALAIGVP QPDVDATVLI GDLMLVGGGA MWGATTLIVK       180
     ASRLQQAPAE KGLAYQVAIS IPILLLAALI SGETIDKMPG PLSLTLMAYQ SIWVVGLTFL       240
     LWFGLVKTYS ASKLSAFTFI TPLFGVAAGY LIMHDPLNPA FGVAALLVIA GLYLVNRPAK       300
     AVPA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page