(data stored in ACNUC7421 zone)

EMBL: CP000283.PE323

CP000283.PE323       Location/Qualifiers
FT   CDS             complement(378222..379013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC6"
FT                   /protein_id="ABE37563.1"
FT                   /translation="MLGGLPDWHRLDPSAEPEAIRRCLESFDPPVEAVAIPWREDLFLD
FT                   SYYLPFERSGTDRAPIAVCIGEMRSKEELLIVMARPARERRLALLCVDSGSDDVEAPRR
FT                   SVRPESCVTAVIDYLVELPGIDPNRIALIADGSPSSLIAKGVVMDGRVAAAVCDGGLWE
FT                   LWEHAQTASLPGYLGAIAPTPIVAAIRCPTLIPLLPGSGIDPVYAKDLLSSHQARDRRI
FT                   AIADLAPQQSEMAPADSRIWAETTLNWVSRQLDGIQKIAER"
     MLGGLPDWHR LDPSAEPEAI RRCLESFDPP VEAVAIPWRE DLFLDSYYLP FERSGTDRAP        60
     IAVCIGEMRS KEELLIVMAR PARERRLALL CVDSGSDDVE APRRSVRPES CVTAVIDYLV       120
     ELPGIDPNRI ALIADGSPSS LIAKGVVMDG RVAAAVCDGG LWELWEHAQT ASLPGYLGAI       180
     APTPIVAAIR CPTLIPLLPG SGIDPVYAKD LLSSHQARDR RIAIADLAPQ QSEMAPADSR       240
     IWAETTLNWV SRQLDGIQKI AER                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page