(data stored in ACNUC7421 zone)

EMBL: CP000283.PE324

CP000283.PE324       Location/Qualifiers
FT   CDS             379721..380266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37564"
FT                   /db_xref="GOA:Q13EC5"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC5"
FT                   /protein_id="ABE37564.1"
FT                   /translation="MTANLLHHTGLGFRPARAARIARNVALTYAVIAAAALGAAWFFQL
FT                   ALDLTPCPLCLEQRYAYYAAIPLAGLIALGAWREAPISLLIAGLAVLAVLALGNAGLGA
FT                   YHAGVEWKFWTGPTDCAGPVLDFGKAGSLLDQLDKVKVMRCDEVQWRFLGLSLAGYNVL
FT                   VSLALAALAAWGIARIRR"
     MTANLLHHTG LGFRPARAAR IARNVALTYA VIAAAALGAA WFFQLALDLT PCPLCLEQRY        60
     AYYAAIPLAG LIALGAWREA PISLLIAGLA VLAVLALGNA GLGAYHAGVE WKFWTGPTDC       120
     AGPVLDFGKA GSLLDQLDKV KVMRCDEVQW RFLGLSLAGY NVLVSLALAA LAAWGIARIR       180
     R                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page