(data stored in ACNUC7421 zone)

EMBL: CP000283.PE325

CP000283.PE325       Location/Qualifiers
FT   CDS             380435..381637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0327"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37565"
FT                   /db_xref="GOA:Q13EC4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC4"
FT                   /protein_id="ABE37565.1"
FT                   /translation="MPSEHRPAPATAPEASLNRLEELPYRRRQQALLREFGTAALQTRD
FT                   FRQILQQAVDLSARGLGCSFAKVLEYVAVEKRLIVRAGIGWPAGTVDHVSLGADIESPA
FT                   GFAFQTGQSVVSNHLQDETRFRTPKLLADHGIKRAINVLIRRGGEGDTAFGVLEADSPD
FT                   PGQFDDADADFLAGFAGLLGIAIERQHADAKLQEALDHEALLTREMSHRVKNSLTSVVG
FT                   LLRVQARGSESADVKNALEDAAMRVASIAGVHDHLWRGSKVGFVDLSDFVSHLCETLQG
FT                   SAPEHVIQCRSDDIILSADKAIPLGLLVNELVTNAIKYAYVDGHGVIRLDAREINGHLL
FT                   VEISDEGAGLPDGFDINQPRKSLGFRVILGLVRQLLGELTISKNLPRGALFTIKFPVDP
FT                   P"
     MPSEHRPAPA TAPEASLNRL EELPYRRRQQ ALLREFGTAA LQTRDFRQIL QQAVDLSARG        60
     LGCSFAKVLE YVAVEKRLIV RAGIGWPAGT VDHVSLGADI ESPAGFAFQT GQSVVSNHLQ       120
     DETRFRTPKL LADHGIKRAI NVLIRRGGEG DTAFGVLEAD SPDPGQFDDA DADFLAGFAG       180
     LLGIAIERQH ADAKLQEALD HEALLTREMS HRVKNSLTSV VGLLRVQARG SESADVKNAL       240
     EDAAMRVASI AGVHDHLWRG SKVGFVDLSD FVSHLCETLQ GSAPEHVIQC RSDDIILSAD       300
     KAIPLGLLVN ELVTNAIKYA YVDGHGVIRL DAREINGHLL VEISDEGAGL PDGFDINQPR       360
     KSLGFRVILG LVRQLLGELT ISKNLPRGAL FTIKFPVDPP                             400
//

If you have problems or comments...

PBIL Back to PBIL home page