(data stored in ACNUC7421 zone)

EMBL: CP000283.PE329

CP000283.PE329       Location/Qualifiers
FT   CDS             384313..384822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC0"
FT                   /protein_id="ABE37569.1"
FT                   /translation="MRAPQIVTIASALMGTALLTLASAAPGHALTAQECSAKYQAAKTA
FT                   GTLNGQGWNDFRKAQCASDSAAEADSKAVEAKDKPEAKSAAKSEAKSEAKPKAKPAEPA
FT                   AASAGPPTFPTAVDAKFAKEPAARARLHTCAEQWKANKAANTTGGLKWIQKGGGYWSEC
FT                   NKRLKA"
     MRAPQIVTIA SALMGTALLT LASAAPGHAL TAQECSAKYQ AAKTAGTLNG QGWNDFRKAQ        60
     CASDSAAEAD SKAVEAKDKP EAKSAAKSEA KSEAKPKAKP AEPAAASAGP PTFPTAVDAK       120
     FAKEPAARAR LHTCAEQWKA NKAANTTGGL KWIQKGGGYW SECNKRLKA                   169
//

If you have problems or comments...

PBIL Back to PBIL home page