(data stored in ACNUC7421 zone)

EMBL: CP000283.PE33

CP000283.PE33        Location/Qualifiers
FT   CDS             39653..40090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37273"
FT                   /db_xref="InterPro:IPR025873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F66"
FT                   /protein_id="ABE37273.1"
FT                   /translation="MLEALSKATFDRDIGRIDPRSVRMYDWAIVQANYPVFDVIFNHAQ
FT                   VAPLRLRLVCDDWDEIPPSIELLNKEGQPLATAPPNVGNVFNGSTHPNTGRPFVCMRGA
FT                   REYHTHGSHTSDLWDNYRGQSGMDLGGIVVQLWRAWKRSVG"
     MLEALSKATF DRDIGRIDPR SVRMYDWAIV QANYPVFDVI FNHAQVAPLR LRLVCDDWDE        60
     IPPSIELLNK EGQPLATAPP NVGNVFNGST HPNTGRPFVC MRGAREYHTH GSHTSDLWDN       120
     YRGQSGMDLG GIVVQLWRAW KRSVG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page