(data stored in ACNUC7421 zone)

EMBL: CP000283.PE331

CP000283.PE331       Location/Qualifiers
FT   CDS             385302..386024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0333"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37571"
FT                   /db_xref="GOA:Q13EB8"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB8"
FT                   /protein_id="ABE37571.1"
FT                   /translation="MSATPFSLWVYLSQTPLLWLTVTLLVYAATDAVSQATERSPLANP
FT                   VLHAIWIIGAFLWLTGTSYTTYFSGAQFVHFLLGPATVALAVPLYENRRQVIAAIVPMA
FT                   LALVVGCIVAIVSVMVLAQLAGLPETVVLSLASKSVTAGVAMGISESLNADPSLTAVAV
FT                   VLTGVMGAIMVTPLMNALGIRDFRARGFSVGLASHGIGTARAFQVDAIAGVFAGIAMSL
FT                   NALITAMLVPVAVTLLVK"
     MSATPFSLWV YLSQTPLLWL TVTLLVYAAT DAVSQATERS PLANPVLHAI WIIGAFLWLT        60
     GTSYTTYFSG AQFVHFLLGP ATVALAVPLY ENRRQVIAAI VPMALALVVG CIVAIVSVMV       120
     LAQLAGLPET VVLSLASKSV TAGVAMGISE SLNADPSLTA VAVVLTGVMG AIMVTPLMNA       180
     LGIRDFRARG FSVGLASHGI GTARAFQVDA IAGVFAGIAM SLNALITAML VPVAVTLLVK       240
//

If you have problems or comments...

PBIL Back to PBIL home page