(data stored in ACNUC7421 zone)

EMBL: CP000283.PE332

CP000283.PE332       Location/Qualifiers
FT   CDS             386266..386733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37572"
FT                   /db_xref="GOA:Q13EB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB7"
FT                   /protein_id="ABE37572.1"
FT                   /translation="MTDASALPTSAAATHRVHGSAPRRAIALLAAVSAIAIALLVSSPE
FT                   ASTLAVASSDAELVMLLRFMAAVKALLALVALGVSVWRLGFPASPVLKVAYTLAPALMC
FT                   AAPVVIWQMADVAFGAGLFHAGFVLLLLALYADRGQAVELAKSAALKLRRA"
     MTDASALPTS AAATHRVHGS APRRAIALLA AVSAIAIALL VSSPEASTLA VASSDAELVM        60
     LLRFMAAVKA LLALVALGVS VWRLGFPASP VLKVAYTLAP ALMCAAPVVI WQMADVAFGA       120
     GLFHAGFVLL LLALYADRGQ AVELAKSAAL KLRRA                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page