(data stored in ACNUC7421 zone)

EMBL: CP000283.PE34

CP000283.PE34        Location/Qualifiers
FT   CDS             40087..40557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37274"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F65"
FT                   /protein_id="ABE37274.1"
FT                   /translation="MSSIICTRSVLERTISIIRRDGNRGEERVALWLATAAQRSPAAIV
FT                   EVYEPEQVVEVDSFYIPPASMRALMNHLRSTRRRIAAQIHTHPGRAYHSDADAKWAIIR
FT                   HSGALSLVLPHFANATTVENFLEEVMTYEYSPAGEWIHCPNVGAGARVVVTA"
     MSSIICTRSV LERTISIIRR DGNRGEERVA LWLATAAQRS PAAIVEVYEP EQVVEVDSFY        60
     IPPASMRALM NHLRSTRRRI AAQIHTHPGR AYHSDADAKW AIIRHSGALS LVLPHFANAT       120
     TVENFLEEVM TYEYSPAGEW IHCPNVGAGA RVVVTA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page