(data stored in ACNUC7421 zone)

EMBL: CP000283.PE348

CP000283.PE348       Location/Qualifiers
FT   CDS             complement(412315..414354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0350"
FT                   /product="3-methylcrotonoyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37588"
FT                   /db_xref="GOA:Q13EA1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EA1"
FT                   /protein_id="ABE37588.1"
FT                   /translation="MMATTALYRRFRTLLIANRGEIACRVIRTARAMGLRTVAVYSEAD
FT                   ADALHVSEADEAVLLGPARARDSYLSIERIIAAAKQTGAEAVHPGYGFLSESAEFAQAC
FT                   ADAGLIFVGPTPQMITAMGSKSGSKALMEKAGVPLVPGYHGEAQDDATLAAAADKIGFP
FT                   VLVKASAGGGGRGMRVVRAANELGEAIVSAKREAKAAFGDDRLLIEKYVDNPRHIEVQI
FT                   VGDSHGNLVSLFERECTLQRRHQKVIEEAPSPTLDAAQRETVCEAARRAAGAVNYVGAG
FT                   TIEFVSDGKDVFFIEMNTRLQVEHPVTELISGVDLVEWQLRVAFGEALPLRQDQLTLNG
FT                   HAIEARVYAENPAKNFMPSVGRISTWRTPAETDGLRIDAGYRAGDSVSPYYDAMLAKVI
FT                   AFAPTRAAAIDRLNRGLEETDVRGVVTNIPFLSALVTHPEVRANAIDTGFIERHLAALT
FT                   AAPAPVSDLELATAVAAILRAETDAARAEAPTPWRSSGWMPVGRRKRGFVFRHGRGHDH
FT                   TDYKVQLAYGTGLATLTIDGRDLAFASLANGDGLDVLLDGARSRVNAVVEGHELYLRTR
FT                   NGRFELHWVDPFGGESEESVGEDKIVAPLPGTVVALLAEQGAKLEKGAAILTLEVMKME
FT                   QTLRAPFAGTLKAIKCKVGDIVQEGVELAEIESAQDATEAQCPS"
     MMATTALYRR FRTLLIANRG EIACRVIRTA RAMGLRTVAV YSEADADALH VSEADEAVLL        60
     GPARARDSYL SIERIIAAAK QTGAEAVHPG YGFLSESAEF AQACADAGLI FVGPTPQMIT       120
     AMGSKSGSKA LMEKAGVPLV PGYHGEAQDD ATLAAAADKI GFPVLVKASA GGGGRGMRVV       180
     RAANELGEAI VSAKREAKAA FGDDRLLIEK YVDNPRHIEV QIVGDSHGNL VSLFERECTL       240
     QRRHQKVIEE APSPTLDAAQ RETVCEAARR AAGAVNYVGA GTIEFVSDGK DVFFIEMNTR       300
     LQVEHPVTEL ISGVDLVEWQ LRVAFGEALP LRQDQLTLNG HAIEARVYAE NPAKNFMPSV       360
     GRISTWRTPA ETDGLRIDAG YRAGDSVSPY YDAMLAKVIA FAPTRAAAID RLNRGLEETD       420
     VRGVVTNIPF LSALVTHPEV RANAIDTGFI ERHLAALTAA PAPVSDLELA TAVAAILRAE       480
     TDAARAEAPT PWRSSGWMPV GRRKRGFVFR HGRGHDHTDY KVQLAYGTGL ATLTIDGRDL       540
     AFASLANGDG LDVLLDGARS RVNAVVEGHE LYLRTRNGRF ELHWVDPFGG ESEESVGEDK       600
     IVAPLPGTVV ALLAEQGAKL EKGAAILTLE VMKMEQTLRA PFAGTLKAIK CKVGDIVQEG       660
     VELAEIESAQ DATEAQCPS                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page