(data stored in ACNUC7421 zone)

EMBL: CP000283.PE359

CP000283.PE359       Location/Qualifiers
FT   CDS             complement(427197..427559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37599"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E90"
FT                   /protein_id="ABE37599.1"
FT                   /translation="MGDIMGVLASGYTSAALQNPSRTPYKNVDEKLYEGTWSGTYSNTK
FT                   KFSITVSDVQGFRAQVRYQSEGSIKFQSVLIKDGSFRVGDTKFTLGANGSASIRTAVSD
FT                   PVTGQVNLVKGTAKLG"
     MGDIMGVLAS GYTSAALQNP SRTPYKNVDE KLYEGTWSGT YSNTKKFSIT VSDVQGFRAQ        60
     VRYQSEGSIK FQSVLIKDGS FRVGDTKFTL GANGSASIRT AVSDPVTGQV NLVKGTAKLG       120
//

If you have problems or comments...

PBIL Back to PBIL home page