(data stored in ACNUC7421 zone)

EMBL: CP000283.PE362

CP000283.PE362       Location/Qualifiers
FT   CDS             429057..429875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0364"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37602"
FT                   /db_xref="GOA:Q13E87"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E87"
FT                   /protein_id="ABE37602.1"
FT                   /translation="MAITSADLITVASGGLVGFILALIGGGGSVLAVPLLVYVVGIRSP
FT                   HVAIGTSSIAVAISALANLLGHWAAGNVRWNCALVFSAAGIGGAFAGSFIAKQIDGQKL
FT                   LLLFGMLMVVIGVLMSRRQSGGGDPTIRLTIATAKTMLPKLIGTGFGVGALAGFFGIGG
FT                   GFLIVPGLILATGMPLTSAIGSSLVAVFAFGASTAASYALSGLIDWRLAGLFISGGLIG
FT                   GLIGIGAGKLIGAHDKVLRGVFSAVVVVVGLYVCYRGVAYFLVAQHPMSL"
     MAITSADLIT VASGGLVGFI LALIGGGGSV LAVPLLVYVV GIRSPHVAIG TSSIAVAISA        60
     LANLLGHWAA GNVRWNCALV FSAAGIGGAF AGSFIAKQID GQKLLLLFGM LMVVIGVLMS       120
     RRQSGGGDPT IRLTIATAKT MLPKLIGTGF GVGALAGFFG IGGGFLIVPG LILATGMPLT       180
     SAIGSSLVAV FAFGASTAAS YALSGLIDWR LAGLFISGGL IGGLIGIGAG KLIGAHDKVL       240
     RGVFSAVVVV VGLYVCYRGV AYFLVAQHPM SL                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page