(data stored in ACNUC7421 zone)

EMBL: CP000283.PE366

CP000283.PE366       Location/Qualifiers
FT   CDS             433595..435286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0368"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37606"
FT                   /db_xref="GOA:Q13E83"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E83"
FT                   /protein_id="ABE37606.1"
FT                   /translation="MRRAGQFFFTLSFSSLTRRILSLNLAGLMALSASILYLSQFRAGL
FT                   IDARAQSLLVQAEIIAGAIAASATVETNTITVDPDRLLDLKPGETYGPPDEFAVLDFPI
FT                   NPERVAPVLRRLISPTKTRARIYDRDGVLILDSRSLYGRGDVMRFDLPPPTAEKPGLIE
FT                   RATIAVRTWLNRGDLPLYRELGPENGNGYQEVADSLKGQKNSVVRINDRGEVIVSVAVP
FT                   VQRFRAIHGALMLSTQGDDIDQMVTAERLAILKIFGLAAVVMFVLSVLLASTIAGPVRR
FT                   LADAAERVRRRIRARVEIPDFTTRRDEIGHLSGALREMTDSLYNRIEAIERFAADVSHE
FT                   LKNPLTSLRSAVETLPLAKNDKSRARLLAVIEHDVKRLDRLISDISDASRLDAELQRQD
FT                   AAPVDLRRLLTTLTLVANETRLGNNAVVEVRFEGPASDPFSVPGHDSRLGQVISNLLSN
FT                   AQSFSHPGGKVQIVCRRRKTEIEIVVDDDGPGIRDDAFEKIFERFYTDRPHQGFGQNSG
FT                   LGLSISKQIVEAHGGKIRAENRPGPRDADGEPTSAGARFVVRLPST"
     MRRAGQFFFT LSFSSLTRRI LSLNLAGLMA LSASILYLSQ FRAGLIDARA QSLLVQAEII        60
     AGAIAASATV ETNTITVDPD RLLDLKPGET YGPPDEFAVL DFPINPERVA PVLRRLISPT       120
     KTRARIYDRD GVLILDSRSL YGRGDVMRFD LPPPTAEKPG LIERATIAVR TWLNRGDLPL       180
     YRELGPENGN GYQEVADSLK GQKNSVVRIN DRGEVIVSVA VPVQRFRAIH GALMLSTQGD       240
     DIDQMVTAER LAILKIFGLA AVVMFVLSVL LASTIAGPVR RLADAAERVR RRIRARVEIP       300
     DFTTRRDEIG HLSGALREMT DSLYNRIEAI ERFAADVSHE LKNPLTSLRS AVETLPLAKN       360
     DKSRARLLAV IEHDVKRLDR LISDISDASR LDAELQRQDA APVDLRRLLT TLTLVANETR       420
     LGNNAVVEVR FEGPASDPFS VPGHDSRLGQ VISNLLSNAQ SFSHPGGKVQ IVCRRRKTEI       480
     EIVVDDDGPG IRDDAFEKIF ERFYTDRPHQ GFGQNSGLGL SISKQIVEAH GGKIRAENRP       540
     GPRDADGEPT SAGARFVVRL PST                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page