(data stored in ACNUC7421 zone)

EMBL: CP000283.PE367

CP000283.PE367       Location/Qualifiers
FT   CDS             435283..435744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0369"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37607"
FT                   /db_xref="GOA:Q13E82"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E82"
FT                   /protein_id="ABE37607.1"
FT                   /translation="MSAAGSSSVHASAVRVGDHAVLIRGPSGSGKSRLAFGLIVAGRTG
FT                   QIPDAELIGDDRVFLERRDGRLWVRPAPELAGMIEVRGLGIRRCPNAPEAVIGLIVDLA
FT                   ADDAARLPEAAAMQIRIEGVELPRVPVAAEFDPLPLVVAALTTIDAVGA"
     MSAAGSSSVH ASAVRVGDHA VLIRGPSGSG KSRLAFGLIV AGRTGQIPDA ELIGDDRVFL        60
     ERRDGRLWVR PAPELAGMIE VRGLGIRRCP NAPEAVIGLI VDLAADDAAR LPEAAAMQIR       120
     IEGVELPRVP VAAEFDPLPL VVAALTTIDA VGA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page