(data stored in ACNUC7421 zone)

EMBL: CP000283.PE376

CP000283.PE376       Location/Qualifiers
FT   CDS             443977..444726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0378"
FT                   /product="protein of unknown function DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37616"
FT                   /db_xref="GOA:Q13E73"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E73"
FT                   /protein_id="ABE37616.1"
FT                   /translation="MLDAAIKALTQILSPPMRSILWRSIGFALALIAVAAIGLQRLLSW
FT                   LANSSELWAEAALGGFQTPLNILSWVFSIAAGLGIVVGAVFLMPAVTSLVAGIFVDEAA
FT                   EHVEREYYPSDQSGVALPVGIAMIETVKTALLTILVYLVALPFLFFAGAGVIVFFVATG
FT                   WLLGREYFELAAMRFRPAADAKAMRRDNATTVFIGGLVIAAFVSIPIVNLATPLFGMAF
FT                   MVHLHKRLSGSRPERIAPDRRDRIDAR"
     MLDAAIKALT QILSPPMRSI LWRSIGFALA LIAVAAIGLQ RLLSWLANSS ELWAEAALGG        60
     FQTPLNILSW VFSIAAGLGI VVGAVFLMPA VTSLVAGIFV DEAAEHVERE YYPSDQSGVA       120
     LPVGIAMIET VKTALLTILV YLVALPFLFF AGAGVIVFFV ATGWLLGREY FELAAMRFRP       180
     AADAKAMRRD NATTVFIGGL VIAAFVSIPI VNLATPLFGM AFMVHLHKRL SGSRPERIAP       240
     DRRDRIDAR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page