(data stored in ACNUC7421 zone)

EMBL: CP000283.PE380

CP000283.PE380       Location/Qualifiers
FT   CDS             449106..449621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37620"
FT                   /db_xref="GOA:Q13E69"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E69"
FT                   /protein_id="ABE37620.1"
FT                   /translation="MALDTDLDPELAQPKLFSALLKPHRALSHKAFLVLMGVLGTISFA
FT                   VGVGFWTMGAWPVFGFFGLDLLAIYIAFRISFARGRASEEISITISELRVRRISHRGHV
FT                   AEWVLNPLWVRLEKIVHAEFGIEQLYLVSRGRRVSVASFLGAEEKASFANALTAALDAA
FT                   RRGPLVRH"
     MALDTDLDPE LAQPKLFSAL LKPHRALSHK AFLVLMGVLG TISFAVGVGF WTMGAWPVFG        60
     FFGLDLLAIY IAFRISFARG RASEEISITI SELRVRRISH RGHVAEWVLN PLWVRLEKIV       120
     HAEFGIEQLY LVSRGRRVSV ASFLGAEEKA SFANALTAAL DAARRGPLVR H                171
//

If you have problems or comments...

PBIL Back to PBIL home page