(data stored in ACNUC7421 zone)

EMBL: CP000283.PE39

CP000283.PE39        Location/Qualifiers
FT   CDS             complement(49431..49802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37279"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F60"
FT                   /protein_id="ABE37279.1"
FT                   /translation="MSSKKRIKPQRKDRDAAAGVQGLVQGSKQRARGDLRWRHRHQIRK
FT                   NGLLLNKIHHAAYDADLRVHISERLLSQQGDPLLAKAVAAMKGAKQRLPRRDKTNKIQI
FT                   GWRKGSSKNKQRCDRYAER"
     MSSKKRIKPQ RKDRDAAAGV QGLVQGSKQR ARGDLRWRHR HQIRKNGLLL NKIHHAAYDA        60
     DLRVHISERL LSQQGDPLLA KAVAAMKGAK QRLPRRDKTN KIQIGWRKGS SKNKQRCDRY       120
     AER                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page