(data stored in ACNUC7421 zone)

EMBL: CP000283.PE398

CP000283.PE398       Location/Qualifiers
FT   CDS             467172..467567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0400"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37638"
FT                   /db_xref="GOA:Q13E51"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E51"
FT                   /protein_id="ABE37638.1"
FT                   /translation="MAKTRSPSTPPAPERVAAFQTGISAETRAAAFLMAKGYRILARRF
FT                   KTPYGEIDIVAQRRKLIAFVEVKARARLDDAAYALTPRQQQRIIAAAEAWLVANPDHAT
FT                   YELRFDAMLVAPKRLPQHLPAAFDASP"
     MAKTRSPSTP PAPERVAAFQ TGISAETRAA AFLMAKGYRI LARRFKTPYG EIDIVAQRRK        60
     LIAFVEVKAR ARLDDAAYAL TPRQQQRIIA AAEAWLVANP DHATYELRFD AMLVAPKRLP       120
     QHLPAAFDAS P                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page