(data stored in ACNUC7421 zone)

EMBL: CP000283.PE4

CP000283.PE4         Location/Qualifiers
FT   CDS             4985..7426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37244"
FT                   /db_xref="GOA:Q13F95"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F95"
FT                   /protein_id="ABE37244.1"
FT                   /translation="MTEPARQPIAETPPSVPAEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGHATAVEVVLNADGSVTVRDDGRGIPVDIHKGEGIS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLILRVWRNGKEHIIEFAHG
FT                   DAVAPLSMVGDANGRRGTEVTFFASPETFTHIEYDFATLEHRLRELAFLNSGVNIVLSD
FT                   MRHAVEKREEMRYEGGVTEFVKYLDRNKKPIVPAPIVLAADLNGIGVEVALWWNETYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRAALTRQVNGYADSNAKKEKIALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVLNEALAAWFEEHPSEAKVIVGKVIEAAAAREA
FT                   ARKARELTRRKGALDIASLPGKLADCQERDPSKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERARFDKMLGSEQIGTLITALGTGIGRDDFDLSKLRYHKIILMTDADVD
FT                   GAHIRTLLLTFFFRQMPALIEGGFLYIAQPPLYKVTRGKSEQYLKDERALEDYLISTGL
FT                   DDCIFRPASGEERSGRDLLALVENARIVRGTLHNLHSRYNRSVVEQAAIAGVLNPRITS
FT                   DIPTANEAAAYIARRLDALADEVERGWVGRFTEGEGFSFERTVRGVKDVAIIDDALLGS
FT                   ADARKLDEYAAILQEAYPRPGVLRRKDTETAIHGPVSLFEAVTDAGRKGVSLQRYKGLG
FT                   EMNPSQLWETTLDTNARSLLQVKVREVDEADDLFTKLMGDVVEPRREFIQENSLSATVD
FT                   V"
     MTEPARQPIA ETPPSVPAEY GAESIRVLKG LDAVRKRPGM YIGDTDDGSG LHHMVYEVVD        60
     NAIDEALAGH ATAVEVVLNA DGSVTVRDDG RGIPVDIHKG EGISAAEVIM TQLHAGGKFD       120
     QNSYKVSGGL HGVGVSVVNA LSSKLILRVW RNGKEHIIEF AHGDAVAPLS MVGDANGRRG       180
     TEVTFFASPE TFTHIEYDFA TLEHRLRELA FLNSGVNIVL SDMRHAVEKR EEMRYEGGVT       240
     EFVKYLDRNK KPIVPAPIVL AADLNGIGVE VALWWNETYH ENVLCFTNNI PQRDGGTHLA       300
     GFRAALTRQV NGYADSNAKK EKIALTGDDC REGLTAVLSV KVPDPKFSSQ TKDKLVSSEV       360
     RPVVENVLNE ALAAWFEEHP SEAKVIVGKV IEAAAAREAA RKARELTRRK GALDIASLPG       420
     KLADCQERDP SKSELFIVEG DSAGGSAKQG RNREFQAVLP LRGKILNVER ARFDKMLGSE       480
     QIGTLITALG TGIGRDDFDL SKLRYHKIIL MTDADVDGAH IRTLLLTFFF RQMPALIEGG       540
     FLYIAQPPLY KVTRGKSEQY LKDERALEDY LISTGLDDCI FRPASGEERS GRDLLALVEN       600
     ARIVRGTLHN LHSRYNRSVV EQAAIAGVLN PRITSDIPTA NEAAAYIARR LDALADEVER       660
     GWVGRFTEGE GFSFERTVRG VKDVAIIDDA LLGSADARKL DEYAAILQEA YPRPGVLRRK       720
     DTETAIHGPV SLFEAVTDAG RKGVSLQRYK GLGEMNPSQL WETTLDTNAR SLLQVKVREV       780
     DEADDLFTKL MGDVVEPRRE FIQENSLSAT VDV                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page