(data stored in ACNUC7421 zone)

EMBL: CP000283.PE404

CP000283.PE404       Location/Qualifiers
FT   CDS             472132..472617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37644"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E45"
FT                   /protein_id="ABE37644.1"
FT                   /translation="MLRFRVLASTLPLLAMGLFARSELIAGPQPCIAVGDHAVQIAPAS
FT                   WLAHLRVGFTEDPARATIRVQIVDSPDAADFAVTDDAGNTDSGACALTPETRLVGIAAH
FT                   PASDEPLIYLTYDAGGGADYRIFVSSNSFTLRQAAALLVGASDRNAPIATASIGSRS"
     MLRFRVLAST LPLLAMGLFA RSELIAGPQP CIAVGDHAVQ IAPASWLAHL RVGFTEDPAR        60
     ATIRVQIVDS PDAADFAVTD DAGNTDSGAC ALTPETRLVG IAAHPASDEP LIYLTYDAGG       120
     GADYRIFVSS NSFTLRQAAA LLVGASDRNA PIATASIGSR S                           161
//

If you have problems or comments...

PBIL Back to PBIL home page