(data stored in ACNUC7421 zone)

EMBL: CP000283.PE405

CP000283.PE405       Location/Qualifiers
FT   CDS             472732..474684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0407"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37645"
FT                   /db_xref="GOA:Q13E44"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E44"
FT                   /protein_id="ABE37645.1"
FT                   /translation="MMRSLRIKSRRRVFARRFPRLVFMLRSLVVFTAAFCGAYGFIVGS
FT                   RAESSGYNPHTFAIGASFLFALACLGLAVQSMRLRWMRRSLHAVALHNEALADRNWELK
FT                   DAEERARTLLESRGELLTLRDDADATTRAKSRLLAMASHEIRTPLNGIIGMSGLLLDTT
FT                   LTPEQATYVRAVKTSGDALLSLIDELLDYSKIDAGKIELDHRPFALAALIEDIAELLAP
FT                   RAQARAIEIAAYVDERLPAQVIGDAARLRQVLLNLAGNAIKFTSSGGVALIAEPGERDG
FT                   EIDLLIRDTGIGIAPEAQARVFREFEQADDGIARNYGGTGLGLSISERIVSGMGGRIVL
FT                   HSRPGIGTTFTVSIPLAAADDPAAAMAFKAPDLAGQTILIAAPQTIEAQLVAHRLQRWN
FT                   AETRVVSDLAAARVLLPDHAWSAILIDAGFGVTEAAALALDAKLHATQRIVMLNPSIRA
FT                   ELLPKLPAAFTGYLVKPLRAASLAARLGGALIDTAAPGIADSDTPGLAAPDQTAQVGRR
FT                   LSILVAEDNDINALLIRSLLTKLGHDAVIADDGEQALQSWRAASADGAPFDLVLMDVQM
FT                   PLLDGIAASRQIRTYEAERQSRRTPILALTANSLAEDRAACLAAGMDGFLVKPLDRDRL
FT                   VGVLADITSSRPVIA"
     MMRSLRIKSR RRVFARRFPR LVFMLRSLVV FTAAFCGAYG FIVGSRAESS GYNPHTFAIG        60
     ASFLFALACL GLAVQSMRLR WMRRSLHAVA LHNEALADRN WELKDAEERA RTLLESRGEL       120
     LTLRDDADAT TRAKSRLLAM ASHEIRTPLN GIIGMSGLLL DTTLTPEQAT YVRAVKTSGD       180
     ALLSLIDELL DYSKIDAGKI ELDHRPFALA ALIEDIAELL APRAQARAIE IAAYVDERLP       240
     AQVIGDAARL RQVLLNLAGN AIKFTSSGGV ALIAEPGERD GEIDLLIRDT GIGIAPEAQA       300
     RVFREFEQAD DGIARNYGGT GLGLSISERI VSGMGGRIVL HSRPGIGTTF TVSIPLAAAD       360
     DPAAAMAFKA PDLAGQTILI AAPQTIEAQL VAHRLQRWNA ETRVVSDLAA ARVLLPDHAW       420
     SAILIDAGFG VTEAAALALD AKLHATQRIV MLNPSIRAEL LPKLPAAFTG YLVKPLRAAS       480
     LAARLGGALI DTAAPGIADS DTPGLAAPDQ TAQVGRRLSI LVAEDNDINA LLIRSLLTKL       540
     GHDAVIADDG EQALQSWRAA SADGAPFDLV LMDVQMPLLD GIAASRQIRT YEAERQSRRT       600
     PILALTANSL AEDRAACLAA GMDGFLVKPL DRDRLVGVLA DITSSRPVIA                  650
//

If you have problems or comments...

PBIL Back to PBIL home page