(data stored in ACNUC7421 zone)

EMBL: CP000283.PE406

CP000283.PE406       Location/Qualifiers
FT   CDS             474891..475904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0408"
FT                   /product="ornithine-acyl[acyl carrier protein]
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37646"
FT                   /db_xref="GOA:Q13E43"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E43"
FT                   /protein_id="ABE37646.1"
FT                   /translation="MRTGRASADSVACGREDPMQTDHLARPKKFIKLLRPEMAGAAAQT
FT                   AITWFKPALRNGDHGKPIAKPALTPATLGRLGALEVRLAQKKQDIKRAQKLRYRVFYQN
FT                   GTAIADAATLLARRDKDAFDRICDHLLVVDHAAKPSLSGKQPVVGTYRLLRQEIADRHG
FT                   GFYTDSEFNIGGMIARHPELRFLELGRSCVLPPYRNKRTVELLWHGIWSYVRQHRVDVM
FT                   IGCASFDGTDPDRLALPLSFLHHYASAPEAWHARAHRSRYVEMNRMPKEAVNQKAALRE
FT                   LPPLIKGYLRLGATIGEGAVIDHQFGTTDVLIIMPVSAISARYIEHFGADATRHAA"
     MRTGRASADS VACGREDPMQ TDHLARPKKF IKLLRPEMAG AAAQTAITWF KPALRNGDHG        60
     KPIAKPALTP ATLGRLGALE VRLAQKKQDI KRAQKLRYRV FYQNGTAIAD AATLLARRDK       120
     DAFDRICDHL LVVDHAAKPS LSGKQPVVGT YRLLRQEIAD RHGGFYTDSE FNIGGMIARH       180
     PELRFLELGR SCVLPPYRNK RTVELLWHGI WSYVRQHRVD VMIGCASFDG TDPDRLALPL       240
     SFLHHYASAP EAWHARAHRS RYVEMNRMPK EAVNQKAALR ELPPLIKGYL RLGATIGEGA       300
     VIDHQFGTTD VLIIMPVSAI SARYIEHFGA DATRHAA                                337
//

If you have problems or comments...

PBIL Back to PBIL home page