(data stored in ACNUC7421 zone)

EMBL: CP000283.PE407

CP000283.PE407       Location/Qualifiers
FT   CDS             complement(476038..476994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0409"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37647"
FT                   /db_xref="GOA:Q13E42"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E42"
FT                   /protein_id="ABE37647.1"
FT                   /translation="MDARSELHHYNPYRVFSRSEWANLRQDTPMTLDLAEVSTLRSLHD
FT                   RLDITEVEEIYLPMSRLLSIHVGAMQQLYYAQRRFLGVVERKMPYIIGVAGSVAVGKST
FT                   TARVLQALLARWSPRPKVDLITTDGFLHPNALLERAGLMQKKGFPESYDLPALLAFLSD
FT                   IKSGRRKVRAPIYSHLTYDIVPNKFAVVDRPDILIVEGVNVLQTGRLPRDGKAVPVVSD
FT                   FFDFSVYIDADEPVLRDWYIRRFLALRDTAFHDPRSYFHRYAPLSDEEATATAIAIWER
FT                   TNLANLEDNILPTRPRATLILKKGADHVVDSVALRRL"
     MDARSELHHY NPYRVFSRSE WANLRQDTPM TLDLAEVSTL RSLHDRLDIT EVEEIYLPMS        60
     RLLSIHVGAM QQLYYAQRRF LGVVERKMPY IIGVAGSVAV GKSTTARVLQ ALLARWSPRP       120
     KVDLITTDGF LHPNALLERA GLMQKKGFPE SYDLPALLAF LSDIKSGRRK VRAPIYSHLT       180
     YDIVPNKFAV VDRPDILIVE GVNVLQTGRL PRDGKAVPVV SDFFDFSVYI DADEPVLRDW       240
     YIRRFLALRD TAFHDPRSYF HRYAPLSDEE ATATAIAIWE RTNLANLEDN ILPTRPRATL       300
     ILKKGADHVV DSVALRRL                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page