(data stored in ACNUC7421 zone)

EMBL: CP000283.PE416

CP000283.PE416       Location/Qualifiers
FT   CDS             482285..483586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0418"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37656"
FT                   /db_xref="GOA:Q13E33"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E33"
FT                   /protein_id="ABE37656.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQADAKRAVAIALRNRWRRLQLEGILR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAIAQVRERKRKDVQARAQIAAEERVLDALVGPGSSPATRDSFRRKLRAGDLNDKEIE
FT                   VETQASSGSPMFEIPGMPGGQIGAISIGDIFGKMGGRTKTRRLTVADSHDILINEEADK
FT                   LLDNDQLVQEAINVVENNGIVFLDEIDKICVRDGRSGGEVSREGVQRDLLPLIEGTTVA
FT                   TKHGAVKTEHILFIASGAFHIAKPSDLLPELQGRLPIRVELNALTRDDMRRILTEPEAS
FT                   LIKQYIALLQTEGVTLEFSDDAIDALADVAVGVNSTVENIGARRLQTVMERVLDEISFV
FT                   APDRGGETIRIDADYVQKNVGDLAKNTDLSRFIL"
     MTDFSPREIV SELDRFIVGQ ADAKRAVAIA LRNRWRRLQL EGILREEVLP KNILMIGPTG        60
     VGKTEIARRL AKLAGAPFLK VEATKFTEVG YVGRDVEQII RDLVEVAIAQ VRERKRKDVQ       120
     ARAQIAAEER VLDALVGPGS SPATRDSFRR KLRAGDLNDK EIEVETQASS GSPMFEIPGM       180
     PGGQIGAISI GDIFGKMGGR TKTRRLTVAD SHDILINEEA DKLLDNDQLV QEAINVVENN       240
     GIVFLDEIDK ICVRDGRSGG EVSREGVQRD LLPLIEGTTV ATKHGAVKTE HILFIASGAF       300
     HIAKPSDLLP ELQGRLPIRV ELNALTRDDM RRILTEPEAS LIKQYIALLQ TEGVTLEFSD       360
     DAIDALADVA VGVNSTVENI GARRLQTVME RVLDEISFVA PDRGGETIRI DADYVQKNVG       420
     DLAKNTDLSR FIL                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page