(data stored in ACNUC7421 zone)

EMBL: CP000283.PE417

CP000283.PE417       Location/Qualifiers
FT   CDS             complement(483691..484287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0419"
FT                   /product="Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37657"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E32"
FT                   /protein_id="ABE37657.1"
FT                   /translation="MKRFVPSLDPPATPRRKRSLSEEERALWDSVAKQVKPLRGRPRLT
FT                   RIDVATAPPATPAEKPQTPPSSQQPVKRPVKLATPMSPPPLASLGRRERSHLSRGRKDI
FT                   DARIDLHGMTQSRAHHALLRFLQRASHDGLSFVLVITGKGSRLGGDPERGVLRRQVPLW
FT                   LSLPEFRAYVVGFDEAHIGHGGEGALYVRVRRARG"
     MKRFVPSLDP PATPRRKRSL SEEERALWDS VAKQVKPLRG RPRLTRIDVA TAPPATPAEK        60
     PQTPPSSQQP VKRPVKLATP MSPPPLASLG RRERSHLSRG RKDIDARIDL HGMTQSRAHH       120
     ALLRFLQRAS HDGLSFVLVI TGKGSRLGGD PERGVLRRQV PLWLSLPEFR AYVVGFDEAH       180
     IGHGGEGALY VRVRRARG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page