(data stored in ACNUC7421 zone)

EMBL: CP000283.PE419

CP000283.PE419       Location/Qualifiers
FT   CDS             complement(485824..486531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0421"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37659"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E30"
FT                   /protein_id="ABE37659.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRNVLGQRTGSERPPFDRAAARDMIPG
FT                   KQDNNVVPMPGTVIDQSPTAPNADVVPPSDRWKGIAEPDSPLAHGLNAVLVQDSSFDAN
FT                   HFLTGAKSAYEMIVMAFANGDRRALRDLLSTEVYDSFDAAIKDREKNERKTETRFVAID
FT                   KAELLGAEVREHTAQLTVKFVSQMISVTRDKAGAIVDGNPDKVADITDVWTFARDISSR
FT                   DPNWKLVGTGSGH"
     MDIYTIIFLA LAVFIFLRLR NVLGQRTGSE RPPFDRAAAR DMIPGKQDNN VVPMPGTVID        60
     QSPTAPNADV VPPSDRWKGI AEPDSPLAHG LNAVLVQDSS FDANHFLTGA KSAYEMIVMA       120
     FANGDRRALR DLLSTEVYDS FDAAIKDREK NERKTETRFV AIDKAELLGA EVREHTAQLT       180
     VKFVSQMISV TRDKAGAIVD GNPDKVADIT DVWTFARDIS SRDPNWKLVG TGSGH            235
//

If you have problems or comments...

PBIL Back to PBIL home page