(data stored in ACNUC7421 zone)

EMBL: CP000283.PE428

CP000283.PE428       Location/Qualifiers
FT   CDS             494578..496458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0430"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37668"
FT                   /db_xref="GOA:Q13E21"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E21"
FT                   /protein_id="ABE37668.1"
FT                   /translation="MRNSYDVIVIGGGHAGCEAAAAAARLGATTALVTHRFATIGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
FT                   AMQAAIRATVHLSVIEGEADALLSADGRVTGIRLADGREFAAGAVVITTGTFLRGLIHL
FT                   GEQSWPAGRIDEAPALGLSRSFEALGFALGRLKTGTPPRLDGRTIDWGAVEMQPGDDPP
FT                   EPFSVLTPAITTPQIECGITRTTPATHAVIRDNVHRSPMYSGQIQSTGPRYCPSIEDKI
FT                   VRFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQRAILKTIPGLERTELVRPGYAI
FT                   EYDHVDPRELEPTLQTKRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAVLAAGGGDPAV
FT                   FDRADGYLGVMIDDLVTRGINEPYRMFTSRAEYRLTLRADNADQRLTDKGLALGCVGAE
FT                   RAAFHRTKMAALADAKALAQSLSITPNEASRHGLSLNRDGQRRSAFDLLSYPEIGWDEV
FT                   KAIWPELAAVSPAIAVHVEIDAKYHVYLARQTADVEAFRRDEGLLLTEIDYAQVPGLSN
FT                   EARNRLERHRPRTVGQAGRLDGITPAALGILAAYLRREARKRPATVSGER"
     MRNSYDVIVI GGGHAGCEAA AAAARLGATT ALVTHRFATI GAMSCNPAIG GLGKGHLVRE        60
     VDALDGLMGR VADAGGIQFR MLNRRKGPAV RGPRAQADRK LYAAAMQAAI RATVHLSVIE       120
     GEADALLSAD GRVTGIRLAD GREFAAGAVV ITTGTFLRGL IHLGEQSWPA GRIDEAPALG       180
     LSRSFEALGF ALGRLKTGTP PRLDGRTIDW GAVEMQPGDD PPEPFSVLTP AITTPQIECG       240
     ITRTTPATHA VIRDNVHRSP MYSGQIQSTG PRYCPSIEDK IVRFGDRDGH QIFLEPEGLD       300
     DPTVYPNGIS TSLPEEVQRA ILKTIPGLER TELVRPGYAI EYDHVDPREL EPTLQTKRLR       360
     GLFLAGQING TTGYEEAAAQ GLVAGLNAVL AAGGGDPAVF DRADGYLGVM IDDLVTRGIN       420
     EPYRMFTSRA EYRLTLRADN ADQRLTDKGL ALGCVGAERA AFHRTKMAAL ADAKALAQSL       480
     SITPNEASRH GLSLNRDGQR RSAFDLLSYP EIGWDEVKAI WPELAAVSPA IAVHVEIDAK       540
     YHVYLARQTA DVEAFRRDEG LLLTEIDYAQ VPGLSNEARN RLERHRPRTV GQAGRLDGIT       600
     PAALGILAAY LRREARKRPA TVSGER                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page