(data stored in ACNUC7421 zone)

EMBL: CP000283.PE43

CP000283.PE43        Location/Qualifiers
FT   CDS             55237..55872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0043"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37283"
FT                   /db_xref="GOA:Q13F56"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F56"
FT                   /protein_id="ABE37283.1"
FT                   /translation="MIAKSRRTRTASQTRQAKPARENRAADKRPALSGDRRQALISEAA
FT                   RLFGNKGYENTSMRDIAAAVGILPGSLYHHFSSKEELFVAVYSFAVSQSVDAVTAAIEP
FT                   RSAPWIRLEAACIAHMQSLLDKSRFAAVLVSHLSVSGLPEQVVALRDSYEAVFKDLIAE
FT                   LPLPAGTDRRIFRLGLLGSMNWAITWYRPGGETPASIARKLLNAIRRD"
     MIAKSRRTRT ASQTRQAKPA RENRAADKRP ALSGDRRQAL ISEAARLFGN KGYENTSMRD        60
     IAAAVGILPG SLYHHFSSKE ELFVAVYSFA VSQSVDAVTA AIEPRSAPWI RLEAACIAHM       120
     QSLLDKSRFA AVLVSHLSVS GLPEQVVALR DSYEAVFKDL IAELPLPAGT DRRIFRLGLL       180
     GSMNWAITWY RPGGETPASI ARKLLNAIRR D                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page