(data stored in ACNUC7421 zone)

EMBL: CP000283.PE431

CP000283.PE431       Location/Qualifiers
FT   CDS             498870..499760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0433"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37671"
FT                   /db_xref="GOA:Q13E18"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E18"
FT                   /protein_id="ABE37671.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEAAHVERPRAQRKVPIEFIKANP
FT                   RNPRRTFSDAELGELSDSIRQHGVIQPIVVRPVKGAQDRFEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDADALEIAIVENVQREDLNPLEEAQGYHALANEFKRSQDDIAKIVGKSRS
FT                   HVANMMRLTRLPDDVLALIAAGQLSAGHARALIGVPDPSAAAKRIVAEGLNVRQTEALA
FT                   HEEGVPERKPQKPRASAAAKPAKDADTLALEKRVSDALGMKVTIEDRDGTGSLQIRYAD
FT                   LDQLDDIIRRLEAGG"
     MADEHRSRLG RGLASLIGDV GGEAAHVERP RAQRKVPIEF IKANPRNPRR TFSDAELGEL        60
     SDSIRQHGVI QPIVVRPVKG AQDRFEIIAG ERRWRAAQRA GLHEVPIVPV DVSDADALEI       120
     AIVENVQRED LNPLEEAQGY HALANEFKRS QDDIAKIVGK SRSHVANMMR LTRLPDDVLA       180
     LIAAGQLSAG HARALIGVPD PSAAAKRIVA EGLNVRQTEA LAHEEGVPER KPQKPRASAA       240
     AKPAKDADTL ALEKRVSDAL GMKVTIEDRD GTGSLQIRYA DLDQLDDIIR RLEAGG           296
//

If you have problems or comments...

PBIL Back to PBIL home page