(data stored in ACNUC7421 zone)

EMBL: CP000283.PE432

CP000283.PE432       Location/Qualifiers
FT   CDS             complement(500113..501141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0434"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37672"
FT                   /db_xref="GOA:Q13E17"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E17"
FT                   /protein_id="ABE37672.1"
FT                   /translation="MVALRGKDVTSFLARPDAARPIILLYGPDSGLVRERADALIASAL
FT                   DDPNDPFALVRLDGDELASEPSRLVDEAMSIPMFGGRRAIRVRAGSRSFVAGVETLAAS
FT                   PPRECRVVIEAGDIKPDNALRKACEKAPSAVAIGCYPDAEADLARLIDDELRHSNLQIG
FT                   RDARAVLMTLLGGDRQASRNEVRKLALYAHGQSEITLDDVMACVSDASDLKLDVIVDAA
FT                   FSGKPAVVESEFAKAMVAGTYPGQIILAAQRHAAFLHKTSLAVEAGAAAATALDSGFPR
FT                   LHFSRKAASETALRNLGAPRLAQIIDQLATAALETRRQATLGAAIAQRTLLSIAVSARR
FT                   RN"
     MVALRGKDVT SFLARPDAAR PIILLYGPDS GLVRERADAL IASALDDPND PFALVRLDGD        60
     ELASEPSRLV DEAMSIPMFG GRRAIRVRAG SRSFVAGVET LAASPPRECR VVIEAGDIKP       120
     DNALRKACEK APSAVAIGCY PDAEADLARL IDDELRHSNL QIGRDARAVL MTLLGGDRQA       180
     SRNEVRKLAL YAHGQSEITL DDVMACVSDA SDLKLDVIVD AAFSGKPAVV ESEFAKAMVA       240
     GTYPGQIILA AQRHAAFLHK TSLAVEAGAA AATALDSGFP RLHFSRKAAS ETALRNLGAP       300
     RLAQIIDQLA TAALETRRQA TLGAAIAQRT LLSIAVSARR RN                          342
//

If you have problems or comments...

PBIL Back to PBIL home page