(data stored in ACNUC7421 zone)

EMBL: CP000283.PE433

CP000283.PE433       Location/Qualifiers
FT   CDS             complement(501189..501749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37673"
FT                   /db_xref="GOA:Q13E16"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E16"
FT                   /protein_id="ABE37673.1"
FT                   /translation="MSSVRPAVARVFARLALAAMLAAPVAGCFQPMYADRGDGSPTLRD
FT                   KLAAVTVPPLDVPNGSRNARIGVEIRNALMFKMYGSATGAPPLYSLALNINSSRSSLIV
FT                   DPNTTLPTIENYGIDANYRLTEIATGKVVMSGSTFSRVEYDIPGQTQRFARTRAGRDAE
FT                   DRAAQEIAENINTRLASFFYAGI"
     MSSVRPAVAR VFARLALAAM LAAPVAGCFQ PMYADRGDGS PTLRDKLAAV TVPPLDVPNG        60
     SRNARIGVEI RNALMFKMYG SATGAPPLYS LALNINSSRS SLIVDPNTTL PTIENYGIDA       120
     NYRLTEIATG KVVMSGSTFS RVEYDIPGQT QRFARTRAGR DAEDRAAQEI AENINTRLAS       180
     FFYAGI                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page