(data stored in ACNUC7421 zone)

EMBL: CP000283.PE436

CP000283.PE436       Location/Qualifiers
FT   CDS             506433..507098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0438"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37676"
FT                   /db_xref="GOA:Q13E13"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E13"
FT                   /protein_id="ABE37676.1"
FT                   /translation="MSGAEVHGLAAVEQEIAQACKEARRERGSVTLIAVSKTFDADSIL
FT                   PVLAAGQRVFGENRVQEAKAKWPALVAGHPGTELHLIGPLQSNKAKEAVALFDAIHSVD
FT                   RESLAEALSKALPLAGRAVELFVQINTGEEPQKAGVAPQDADAFLTACRERWGLTIAGL
FT                   MCIPPVDEAPAPHFALTAKIARRNGLSKLSMGMSADFATAIEFGATHVRVGSAIFGHR"
     MSGAEVHGLA AVEQEIAQAC KEARRERGSV TLIAVSKTFD ADSILPVLAA GQRVFGENRV        60
     QEAKAKWPAL VAGHPGTELH LIGPLQSNKA KEAVALFDAI HSVDRESLAE ALSKALPLAG       120
     RAVELFVQIN TGEEPQKAGV APQDADAFLT ACRERWGLTI AGLMCIPPVD EAPAPHFALT       180
     AKIARRNGLS KLSMGMSADF ATAIEFGATH VRVGSAIFGH R                           221
//

If you have problems or comments...

PBIL Back to PBIL home page