(data stored in ACNUC7421 zone)

EMBL: CP000283.PE449

CP000283.PE449       Location/Qualifiers
FT   CDS             complement(519000..519338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0451"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37689"
FT                   /db_xref="GOA:Q13E00"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E00"
FT                   /protein_id="ABE37689.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVDSALAEKAVEVITRSARTGQIGDGKIFVTPLDHALRIRT
FT                   GETDADAL"
     MKLVVAIIKP FKLDEVRQAL TEIGVHGMTV TEVKGYGRQR GHTEIYRGAE YIVNFLPKLR        60
     IEIAVDSALA EKAVEVITRS ARTGQIGDGK IFVTPLDHAL RIRTGETDAD AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page