(data stored in ACNUC7421 zone)

EMBL: CP000283.PE455

CP000283.PE455       Location/Qualifiers
FT   CDS             complement(524645..525583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0457"
FT                   /product="LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37695"
FT                   /db_xref="GOA:Q13DZ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ4"
FT                   /protein_id="ABE37695.1"
FT                   /translation="MRFDLIDLRLFVNIVQSGSITRGAEASHMALASASERVSGMESLL
FT                   GTPLLRRERRGVAPTAAGRALLHHARSVTLQIERMRGDLRAFSAGMRGEVRMLSNTAGL
FT                   VDLVPAALRRFLTAHPNVDVDLEERTSMEIVQAVAEGQAEFGVIAGTADPGALDIRTLI
FT                   VDRLAVLAARTHPLAAREAVGFAELLDERFVGLGAGALHDHLQQHAAQLGRRIAYRVRL
FT                   SSFEAVARLVEAGVGLAILPMSAIDRHPADDVTAIALTDAWSQRQLLVCAIDFGELTTH
FT                   ARLLVEELQRQAGKLDDHLGPSPVTAGPQSP"
     MRFDLIDLRL FVNIVQSGSI TRGAEASHMA LASASERVSG MESLLGTPLL RRERRGVAPT        60
     AAGRALLHHA RSVTLQIERM RGDLRAFSAG MRGEVRMLSN TAGLVDLVPA ALRRFLTAHP       120
     NVDVDLEERT SMEIVQAVAE GQAEFGVIAG TADPGALDIR TLIVDRLAVL AARTHPLAAR       180
     EAVGFAELLD ERFVGLGAGA LHDHLQQHAA QLGRRIAYRV RLSSFEAVAR LVEAGVGLAI       240
     LPMSAIDRHP ADDVTAIALT DAWSQRQLLV CAIDFGELTT HARLLVEELQ RQAGKLDDHL       300
     GPSPVTAGPQ SP                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page