(data stored in ACNUC7421 zone)

EMBL: CP000283.PE456

CP000283.PE456       Location/Qualifiers
FT   CDS             525665..526414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0458"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37696"
FT                   /db_xref="GOA:Q13DZ3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ3"
FT                   /protein_id="ABE37696.1"
FT                   /translation="MSEVFLLIGAGALAGAMNATAGGGSFVTLPALIGVGVPSVLANAS
FT                   STIALYPGGLASAWVYRDGFSRVAGVPLGTMLLTTLFGGLIGALLLLWTPTSLFDRVLP
FT                   WLLLLATLALAFGRRLGPALRARFRTGIVTLLVIQFLLGVYGGYFGGAVGLMMMAAWNL
FT                   LDGADVKALNPPRTLLVSAANTVAVICFIVAGAVRWPEALLVGAGAILGGYFGAILGKA
FT                   LPSSVVKSATVLLAAAMTIHFFLRAYA"
     MSEVFLLIGA GALAGAMNAT AGGGSFVTLP ALIGVGVPSV LANASSTIAL YPGGLASAWV        60
     YRDGFSRVAG VPLGTMLLTT LFGGLIGALL LLWTPTSLFD RVLPWLLLLA TLALAFGRRL       120
     GPALRARFRT GIVTLLVIQF LLGVYGGYFG GAVGLMMMAA WNLLDGADVK ALNPPRTLLV       180
     SAANTVAVIC FIVAGAVRWP EALLVGAGAI LGGYFGAILG KALPSSVVKS ATVLLAAAMT       240
     IHFFLRAYA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page