(data stored in ACNUC7421 zone)

EMBL: CP000283.PE457

CP000283.PE457       Location/Qualifiers
FT   CDS             complement(526524..527306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0459"
FT                   /product="histidine kinase, HAMP region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37697"
FT                   /db_xref="GOA:Q13DZ2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ2"
FT                   /protein_id="ABE37697.1"
FT                   /translation="MQFDLSNRNLSQKISILVLGITFFVALAIGGVGEMILHKVGADQA
FT                   KQSASVASLDRLVGLGGATLSPVRAADGSIVGMLVMQQDAGPVVMPASYEGQGLVVQAA
FT                   ETVAAPAADYALSAAHTMLLLAGIVVFAVVGLVGTRISRGLLAPLGELEKDVARLASGD
FT                   TSIRIHALSRSDEIGRIARSIAKIQESLIELARLKTQKVVGGATSVMENLKEMWGDLKS
FT                   AARNAREMLFTDGRTVGETLTRSWNDWVHNGLGVPKRA"
     MQFDLSNRNL SQKISILVLG ITFFVALAIG GVGEMILHKV GADQAKQSAS VASLDRLVGL        60
     GGATLSPVRA ADGSIVGMLV MQQDAGPVVM PASYEGQGLV VQAAETVAAP AADYALSAAH       120
     TMLLLAGIVV FAVVGLVGTR ISRGLLAPLG ELEKDVARLA SGDTSIRIHA LSRSDEIGRI       180
     ARSIAKIQES LIELARLKTQ KVVGGATSVM ENLKEMWGDL KSAARNAREM LFTDGRTVGE       240
     TLTRSWNDWV HNGLGVPKRA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page