(data stored in ACNUC7421 zone)

EMBL: CP000283.PE460

CP000283.PE460       Location/Qualifiers
FT   CDS             complement(530582..531880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0462"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37700"
FT                   /db_xref="GOA:Q13DY9"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY9"
FT                   /protein_id="ABE37700.1"
FT                   /translation="MTPDDIAGFYAKRSDLNLDDYIELDFDFECAGDPREAAAHLCSEQ
FT                   STAQWRRVGVDEDFRPRFAAKVLELHAEPRPSGFSTPVECAVRGEVHACRVTIAHPHGN
FT                   FGPKIPNLLSAVCGEGVFFSPGIPLIRLQDIRFPDSYLAAFAGPQFGVAGLRERLKAFD
FT                   RPIFFGVIKPNIGLSAEPFAELGYQSWLGGLDIAKDDEMLADVDWCPLAERAALLGDAC
FT                   RRAEAETGVPKIYLANITDEVDRLIELHDLAVSNGAGALLVNAMPVGLSAVRMLRKHAT
FT                   VPLIAHFPFIAAFSRLANYGIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVMDCVR
FT                   ACLEPMGPIKPCLPVPGGSDSAATLESVYRKVGCADFGFVPGRGVFGHPMGPAAGAASI
FT                   RQAWDAIASGIAVSDHAARHPELAAALRAFGGR"
     MTPDDIAGFY AKRSDLNLDD YIELDFDFEC AGDPREAAAH LCSEQSTAQW RRVGVDEDFR        60
     PRFAAKVLEL HAEPRPSGFS TPVECAVRGE VHACRVTIAH PHGNFGPKIP NLLSAVCGEG       120
     VFFSPGIPLI RLQDIRFPDS YLAAFAGPQF GVAGLRERLK AFDRPIFFGV IKPNIGLSAE       180
     PFAELGYQSW LGGLDIAKDD EMLADVDWCP LAERAALLGD ACRRAEAETG VPKIYLANIT       240
     DEVDRLIELH DLAVSNGAGA LLVNAMPVGL SAVRMLRKHA TVPLIAHFPF IAAFSRLANY       300
     GIHSRVMTRL QRLAGFDVVI MPGFGPRMMT PEHEVMDCVR ACLEPMGPIK PCLPVPGGSD       360
     SAATLESVYR KVGCADFGFV PGRGVFGHPM GPAAGAASIR QAWDAIASGI AVSDHAARHP       420
     ELAAALRAFG GR                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page