(data stored in ACNUC7421 zone)

EMBL: CP000283.PE461

CP000283.PE461       Location/Qualifiers
FT   CDS             complement(532026..532454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0463"
FT                   /product="protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37701"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY8"
FT                   /protein_id="ABE37701.1"
FT                   /translation="MNIVRHRIELATTAPIQIIDITEQVRGFVAGSGLGDGLVTVSCLH
FT                   TTARINVNEREPQLERDMLTFLKRFAPRDGDYLHNLAPIDGRDNAHSHLIGLFMNSSET
FT                   IPLAGGAMVLGEWQSIFFIELDGPRERRGVELQIIGQV"
     MNIVRHRIEL ATTAPIQIID ITEQVRGFVA GSGLGDGLVT VSCLHTTARI NVNEREPQLE        60
     RDMLTFLKRF APRDGDYLHN LAPIDGRDNA HSHLIGLFMN SSETIPLAGG AMVLGEWQSI       120
     FFIELDGPRE RRGVELQIIG QV                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page