(data stored in ACNUC7421 zone)

EMBL: CP000283.PE463

CP000283.PE463       Location/Qualifiers
FT   CDS             complement(534811..535989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0465"
FT                   /product="putative AlgJ protein, required for O-acetylation
FT                   of alginate in Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37703"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY6"
FT                   /protein_id="ABE37703.1"
FT                   /translation="MAAATTRAGQWLRRLAAAAVLLMPVLTLWNIAVPSRAFNIGPSLI
FT                   GVTKQTPLDLSLRAFLDGTLQKTAAIRIAEAMPLRRTLIRLNNQIAYSLFGEVNAPGIL
FT                   AGVGGQLVERSYLEEYCTRSDGDADRLADTVVPLLRNLQAYYRDRGAIFLYVVTPSKVA
FT                   HLPQHFVHLISCRSTDAARVELVPRYVARLRAAGIDVVDAATSTHALKGQYPVELFPRG
FT                   GIHWNDQAMARASQQIVEAVNRQAGRELLPQFDFTSTVSLPPEGRDRDLAELINLLVSP
FT                   LDYATPKLTFSNPPCAGQPARTIDAAIVGGSFMDAVGEVLTESACMARLSQYFYLKLGR
FT                   YGGTRRQLIQENLSDSDLQRLRDVDIMLLEENESAIGRQGYLTLLHHIVTDK"
     MAAATTRAGQ WLRRLAAAAV LLMPVLTLWN IAVPSRAFNI GPSLIGVTKQ TPLDLSLRAF        60
     LDGTLQKTAA IRIAEAMPLR RTLIRLNNQI AYSLFGEVNA PGILAGVGGQ LVERSYLEEY       120
     CTRSDGDADR LADTVVPLLR NLQAYYRDRG AIFLYVVTPS KVAHLPQHFV HLISCRSTDA       180
     ARVELVPRYV ARLRAAGIDV VDAATSTHAL KGQYPVELFP RGGIHWNDQA MARASQQIVE       240
     AVNRQAGREL LPQFDFTSTV SLPPEGRDRD LAELINLLVS PLDYATPKLT FSNPPCAGQP       300
     ARTIDAAIVG GSFMDAVGEV LTESACMARL SQYFYLKLGR YGGTRRQLIQ ENLSDSDLQR       360
     LRDVDIMLLE ENESAIGRQG YLTLLHHIVT DK                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page